From 9c1a7818b2df20a925b58eec72a97fa532b34990 Mon Sep 17 00:00:00 2001 From: Florent DENEF Date: Tue, 27 Dec 2022 14:11:29 +0100 Subject: [PATCH 01/19] Day 6 started --- prob6_part1.txt | 1 + src/lib.rs | 5 ++++- src/main.rs | 7 ++++++- src/prob6.rs | 5 +++++ 4 files changed, 16 insertions(+), 2 deletions(-) create mode 100644 prob6_part1.txt create mode 100644 src/prob6.rs diff --git a/prob6_part1.txt b/prob6_part1.txt new file mode 100644 index 0000000..fa3b80f --- /dev/null +++ b/prob6_part1.txt @@ -0,0 +1 @@ +bhzhtzzsczszsjjjzddfzdfzfjfzfbbnntnzznwzzvfvrrqmrmmdzzfqfhqhsqqpwpgwpppbtbnnstthmhrrsmmvsmmhjmjfmfsfjfnfnjjvcjjszjszjsszbznzbnzndzzmlldsdgdcddmqmfqqlcllbvllztzctzczdzttlmtlthtmhtmhmmszsllvzvdzzzsqzqbqccvfvcffzsfslfsllcglclwlvwvzzdsslggtzzgzdzmzddjljvvztttsgscsstztjztjztzvzwwthtftppnmpmmcpmmjlmjjjsfjsjppgcgwcggzffzwzbbmbrbprpqqpccfncfnffvcffsqqtzqzqwzwvzwwwbjbfbcbfblltnlnhhcthtvvzzfcfgfddlggbbshsggplglqqbrbggsvvzdvvlfvlvpvhhmggbrrnppjfjhffttfpffbdfbfvfqvvtcvvbvnnhbhhglgjgzzghhwrrtntrtwwfdfdmmcmtctftpptllzqllzflfrrgqgvgdvdfdbddprrrgccqvqnnmtmvmffpzzqggfbfnfwwqdqldqqlnqnttnbttrffnmmzwzjjtrjtrtmmqsmqmffqmfqfhhbthbhdhvdhvdvmvdmdhdshsqslldzztvvmzzdcccmbbhfhshrrrpsrrqqmdmmgdmmwdmdjdqqmcmttpgtgwgpwpprbrprhrsrllhsllprlplhppfzpffbhbccwdwbbrpbpvpqqmsspjssmbbmfmrmnrnwwgbwwbpwpjwwhqqgcqcvqccgffzpfftcffqlqjjznnlflhhlcczhzvhzhmzhmhfhnnqznntstwtggqjgjhggsvslltjlttfjjgffjzjwzzqzrrhlhzhbhphmhlmlzmzsmzmccvllgrrpbrbfbjfjttqjttdrdhhggqgddppqgpqgpgtptjptpllwccmwcmcpmcppdrrtstqqczqzvvlsltlddnvdvggcqqblqqsjqjttzhtzzszllqsqfqddqdbqddwqddfzzlczcscfsfpfdpdrpddsggcqchcfcpcssstwstwtggghvhqhzzqssjddwjwbjjsnjnfnwwglwwfnfhnnscsggzgjzzhzmmqfqsqwqrwqqqdtdcttzvvnbngbbcdbdggddnmddgzghhzgghwwbjbttlwlcctlccwwdhhrqrvrjjlglssgttpllwclwwtptwptwtvthtbhbzhbzhhrsrwwwnrwrfwfnwnhhnqqdjqjpqqwdwttzhttcdttvztzltzlzmzddrsdsfdsfftdfffmwffrjrffqrfqfsfqqqgqjggwzzrnnqfnqffdbfbtbbrpbrpbptpwttjmjjzrrhhqppdzdtdjttqwwtddjdzzmgzzhwwwdsdgssprsrgsgbbphhdpdwppnfppdqqwzzpbzzqwqpqsqhqdhqqtwwjnnmvmwvmmwwgjgzjjvcjcvcjcnjcncmmphmmvmwmwpwbbtbffhnhshgssgvgvrrbwbtbddqmqfqvvfqvqdvvdbvdbdcdfdlflmffrwwgmmttrztrrfrqrpqrrzjrjpjdpjprrnhhbhcbbcwwqlwwcssbddfrfjrfjfrjfjvvdmdtdzzlvzlzhzmhmhphchnnfqnffvccfpfbfpfqpprrmttzrzzjzmjmzjmmfvmmrzrqqdllgjlglcchssgllsbllrbrlrjlrrhhfwwsqwsstpssznzcznzqzssvtvtrrqwqvvtssgfsfhssljjnwjnjddjdggclcrrfsfhsstgtdtctfttvvsbvvbtbttcgcssjlslhlpljpppwzwnwdnngmgjjbzznwwdllrrfppshhvdhhldhdbbdbjbdjjrnjjzhzfhhsqqbqgmsbvnjsptlrsszlqfmgprvscphmqztbgtlrqvcgdzcptcqjncrdtfqnghnbmwwmcjgtjlbvqqzslgbbntrdfnvfjvfgcgngndjcspgwmpnsrqzzvzljbzlzzrwflrqqqmhsvqwbmdftnhwwzgqrlhddbbtwvbphljmstcjzvpjqwcnhlvpqvqdgvntgqzqwrlwbwvngwtqgrhznlzcvbwqmwncccjctrdzrmzjsvrmcfpjjcczhbvdfwhqvczggfmrspvprvvthvtqnsphpcsdmbrtbdqljvssdrhwjsrrlzprstpgqcbpmnpdgzgjttwcfrgjnsghmszlclgvmlsjrqfvflbnhwwphtvrnrbhdvdglcvgpzfsjpwwhtlvvdzthsrldfzhnlrblzsjjnwclqsqzgdbflhvpwcrtfbfbjcjttbjpvfgvfcswnqqwshbmqlscdzzwshfqwsvwnwzltbnrmzzhzvtwpzqcgwshpvzgtcmwrtrwctnpzbznnwqphnrgwljtrcwlqmvlndwrdrctztnmswslqmbjcmtlrmcpjvzccqszrnflqnqzttbhqlrhbmqdpscqvfgtdbnwjdcljwcbgbgjfzgrgpwqzqgbnrtpntfthhdbqmswvhnmwmszpghgjjzrbnbbfjblpstdfslmmmqfdcrhblqjqfphnldrvvfpnfrcvprjnqbzbspfpjtgqhnjbhnrwzcjvdbshhqpgrmzqpmjfmqwqvvdbddbsldwzzsrhnhsjjnvljrbwcnjrnjpmrrvfthftgptgtlpbgqffthflgftwcrqcqwqwrmrcmfrcqgmrnqjbscdcgrqlhjzthvzdgjbvpswflqcgsnlmgmvcsttsgmnqdtvwdvrndvfdcvrcwmqlmlhtrvthsndsrmnsfmdmfnpfmfhzjqmtcjzcrnsjdztztvgdtlrmbdmmstbfgpmmzthcslpvgrpgfljfgqlqhldfwvvvdvbzjtdtppbtrnqwsqztjrsjhtfrgmvsdngvsdzjgpwrldqpzdpvhljzpjvttwltdwcrhcbrgrvdrmpwvdwjchqsjfprbgtjtzggvgrgmlvvwqrjfprbbgjjqrtdfnrdffwbswbvqtqtfsrhsgrjhftqldhmcnmsnfflmdrzqdjmbqqgqsttdmtrrvfsjnccnhcpcvqtrzdjzrpwswmjvvgsgwvnmdgqwlctrlhqnsmczbwsjhmtgvdcgsndzlstcwchcztqqbtdwfvlljdvdlzljslgnzpmqvzfcvqhdzvgchffqgfwrnmwqzwgbzblpmvddlvnhglrhdnwzqwztzgjczjpwcjwmpnrnrhncfjfggrbphrjztwtfqmfjlwfhnqfftfghbnvtwgtmdzzrdrtmfrwhrrbhzmcllsgqzwzzqtgdggvzptvtdcpzmtmsfcfbjtzlbdrwhdbtdhhrgggmddnzsvjwgcdcqfppqwphfvlhmgqsznlhmgpnjvcvrwwppnphchgsrhjwjcpjggsrcwrvnllfgrmjltfzwhmbqwpwwzmrtlqcprrqztcgnghcbvzrbfptjmhtdcfhhffdbrswqpnpppnpqwtflrrmqgjzctmmvvvwzllbsfdvpqjtmvpjcpmjztscsgbdznfgcmtjzdqzwqrsvstnnvddcstzqjtnbsnlptpmbmfqmhppgnjrffqrtchgptbmwlwbwbcqqfngpbwtwdmlmdstmqwcwjtbwbbbhghgptmvhfmvqfvpwqzwnbjdhpwlgjgvprdjbnlzhnllssbpvzfzspwsscfpqtpdvtzvqncfrfrgddsdglqvpblmpcczlqfdmwzmgvrljhqtcglcvfhbdwhbttqqrjbqwhsrhrbjwmtqwqddvdggdwfsmnpbpvvgsqnvvrqntwmbzdnqpmmqtbnlsbmslpfmqjtgvbddhwvlvjtlrhqdpfnjwtbhwjwdrpgctbbrdqvbbnvgqwngrhqfvwzmlqtmhfqphnmczlbdpnbmpvwrsjbcnjnvcfgnsvlhpzdgdzgvfbgwdcrswznrggnghzssdwqvvlwftqhbnwdvghhvjlqqmcnqmvbwhrrnsswlwmwbsmpcpdzzgmcmqnzpvjpzqbwcsgdhqtqhcpbtqftvscmntsbdcbrndvlfhprpblzbjcpqhfljtvnvtgvrcgqbsgl \ No newline at end of file diff --git a/src/lib.rs b/src/lib.rs index c73f603..5762b5f 100644 --- a/src/lib.rs +++ b/src/lib.rs @@ -1,5 +1,8 @@ +extern crate core; + pub mod prob1; pub mod prob2; pub mod prob3; pub mod prob4; -pub mod prob5; \ No newline at end of file +pub mod prob5; +pub mod prob6; \ No newline at end of file diff --git a/src/main.rs b/src/main.rs index 61fcaa7..0dac79c 100644 --- a/src/main.rs +++ b/src/main.rs @@ -1,4 +1,4 @@ -use advent_of_code::{prob1, prob2, prob3, prob4, prob5}; +use advent_of_code::{prob1, prob2, prob3, prob4, prob5, prob6}; fn main() { { @@ -43,4 +43,9 @@ fn main() { let max_part1 = prob5::solve_part2(file_path); println!("Solution for problem 5 part 2: {max_part1}"); } + { + let file_path = "prob6_part1.txt"; + let solution = prob6::solve_part1(file_path); + println!("Solution for problem 6 part 1: {solution}"); + } } diff --git a/src/prob6.rs b/src/prob6.rs new file mode 100644 index 0000000..51f5976 --- /dev/null +++ b/src/prob6.rs @@ -0,0 +1,5 @@ +pub fn solve_part1(file_path: &str) -> i32 { + let _content = std::fs::read_to_string(file_path).unwrap_or_else(|err| panic!("{err}")); + println!("{_content}"); + 0 +} From 63a4047c302f063ee20821ac722d85f0057191af Mon Sep 17 00:00:00 2001 From: Florent DENEF Date: Tue, 27 Dec 2022 16:53:33 +0100 Subject: [PATCH 02/19] Using regex but will try to solve the problem without it., --- Cargo.toml | 1 + src/main.rs | 4 ++-- src/prob6.rs | 48 ++++++++++++++++++++++++++++++++++++++++++++---- 3 files changed, 47 insertions(+), 6 deletions(-) diff --git a/Cargo.toml b/Cargo.toml index bf7e11d..2a90492 100644 --- a/Cargo.toml +++ b/Cargo.toml @@ -13,3 +13,4 @@ rpath = true [dependencies] nom = "7.1.1" itertools = "0.10.5" +fancy-regex = { version = "0.10.0", features = ["perf-literal", "perf-dfa", "perf-inline", "perf-cache"] } diff --git a/src/main.rs b/src/main.rs index 0dac79c..5a7723d 100644 --- a/src/main.rs +++ b/src/main.rs @@ -44,8 +44,8 @@ fn main() { println!("Solution for problem 5 part 2: {max_part1}"); } { - let file_path = "prob6_part1.txt"; - let solution = prob6::solve_part1(file_path); + let _file_path = "prob6_part1.txt"; + let solution = prob6::solve_part1(include_str!("../prob6_part1.txt")); println!("Solution for problem 6 part 1: {solution}"); } } diff --git a/src/prob6.rs b/src/prob6.rs index 51f5976..1d12c54 100644 --- a/src/prob6.rs +++ b/src/prob6.rs @@ -1,5 +1,45 @@ -pub fn solve_part1(file_path: &str) -> i32 { - let _content = std::fs::read_to_string(file_path).unwrap_or_else(|err| panic!("{err}")); - println!("{_content}"); - 0 +use std::collections::HashSet; + +use fancy_regex::Regex; + +/// Tries to find the 4 character match. +/// +/// # Arguments +/// +/// * `datagram`: +/// +/// returns: () +/// +/// # Examples +/// +/// ``` +/// +/// ``` +fn begin_datagram(datagram: &str) { + let mut letters = HashSet::::new(); + let mut primary_iter = datagram.chars().fuse(); + let mut motif_iter = primary_iter.clone(); + while letters.len() < 4 { + if let Some(tmp) = motif_iter.next() { + if !letters.insert(tmp) { + letters.clear(); + } + } else { + break; + } + } +} + +pub fn solve_part1(content: &str) -> i32 { + let _content = content; + return match Regex::new(r"^.*(.).*\1.*$") { + Ok(_reg) => { + println!("Regex is built."); + 0 + } + Err(err) => { + eprintln!("{err}"); + 0 + } + }; } From 9a050b663d3dbfc206ebdf43a563589970311978 Mon Sep 17 00:00:00 2001 From: Florent DENEF Date: Wed, 28 Dec 2022 16:53:51 +0100 Subject: [PATCH 03/19] End of day commit --- src/prob6.rs | 16 ++++++++++++++-- 1 file changed, 14 insertions(+), 2 deletions(-) diff --git a/src/prob6.rs b/src/prob6.rs index 1d12c54..a713d5e 100644 --- a/src/prob6.rs +++ b/src/prob6.rs @@ -17,7 +17,7 @@ use fancy_regex::Regex; /// ``` fn begin_datagram(datagram: &str) { let mut letters = HashSet::::new(); - let mut primary_iter = datagram.chars().fuse(); + let primary_iter = datagram.chars().fuse(); let mut motif_iter = primary_iter.clone(); while letters.len() < 4 { if let Some(tmp) = motif_iter.next() { @@ -32,9 +32,21 @@ fn begin_datagram(datagram: &str) { pub fn solve_part1(content: &str) -> i32 { let _content = content; - return match Regex::new(r"^.*(.).*\1.*$") { + return match Regex::new(r"^(?:([A-Za-z])(?!.*\1))*$") { Ok(_reg) => { println!("Regex is built."); + match _reg.find(_content) { + Ok(matches) => { + if let Some(yay) = matches { + println!("{}", yay.as_str()); + } else { + println!("Snif no match :("); + } + } + Err(err) => { + eprintln!("{err}") + } + } 0 } Err(err) => { From 6a8ea1b39211f4db45d718cc10d3a0d244cf6829 Mon Sep 17 00:00:00 2001 From: Florent DENEF Date: Thu, 29 Dec 2022 13:55:39 +0100 Subject: [PATCH 04/19] Day - part 1 done hehehe --- Cargo.toml | 1 - src/prob6.rs | 60 +++++++--------------------------------------------- 2 files changed, 8 insertions(+), 53 deletions(-) diff --git a/Cargo.toml b/Cargo.toml index 2a90492..bf7e11d 100644 --- a/Cargo.toml +++ b/Cargo.toml @@ -13,4 +13,3 @@ rpath = true [dependencies] nom = "7.1.1" itertools = "0.10.5" -fancy-regex = { version = "0.10.0", features = ["perf-literal", "perf-dfa", "perf-inline", "perf-cache"] } diff --git a/src/prob6.rs b/src/prob6.rs index a713d5e..7705414 100644 --- a/src/prob6.rs +++ b/src/prob6.rs @@ -1,57 +1,13 @@ -use std::collections::HashSet; +use itertools::Itertools; -use fancy_regex::Regex; - -/// Tries to find the 4 character match. -/// -/// # Arguments -/// -/// * `datagram`: -/// -/// returns: () -/// -/// # Examples -/// -/// ``` -/// -/// ``` -fn begin_datagram(datagram: &str) { - let mut letters = HashSet::::new(); - let primary_iter = datagram.chars().fuse(); - let mut motif_iter = primary_iter.clone(); - while letters.len() < 4 { - if let Some(tmp) = motif_iter.next() { - if !letters.insert(tmp) { - letters.clear(); - } - } else { - break; - } - } +fn begin_datagram(datagram: &str, size: usize) -> usize { + size + datagram + .as_bytes() + .windows(size) + .position(|window| window.iter().tuple_combinations().all(|(a, b)| a != b)) + .unwrap() } pub fn solve_part1(content: &str) -> i32 { - let _content = content; - return match Regex::new(r"^(?:([A-Za-z])(?!.*\1))*$") { - Ok(_reg) => { - println!("Regex is built."); - match _reg.find(_content) { - Ok(matches) => { - if let Some(yay) = matches { - println!("{}", yay.as_str()); - } else { - println!("Snif no match :("); - } - } - Err(err) => { - eprintln!("{err}") - } - } - 0 - } - Err(err) => { - eprintln!("{err}"); - 0 - } - }; + begin_datagram(content, 4) as i32 } From 58e7eb909e2373f229ab6f45b59cf10469bcd1b4 Mon Sep 17 00:00:00 2001 From: Florent DENEF Date: Thu, 29 Dec 2022 13:55:59 +0100 Subject: [PATCH 05/19] Day 6 part 2 done --- src/main.rs | 5 +++++ src/prob6.rs | 4 ++++ 2 files changed, 9 insertions(+) diff --git a/src/main.rs b/src/main.rs index 5a7723d..697cdec 100644 --- a/src/main.rs +++ b/src/main.rs @@ -48,4 +48,9 @@ fn main() { let solution = prob6::solve_part1(include_str!("../prob6_part1.txt")); println!("Solution for problem 6 part 1: {solution}"); } + { + let _file_path = "prob6_part1.txt"; + let solution = prob6::solve_part2(include_str!("../prob6_part1.txt")); + println!("Solution for problem 6 part 2: {solution}"); + } } diff --git a/src/prob6.rs b/src/prob6.rs index 7705414..53672b6 100644 --- a/src/prob6.rs +++ b/src/prob6.rs @@ -11,3 +11,7 @@ fn begin_datagram(datagram: &str, size: usize) -> usize { pub fn solve_part1(content: &str) -> i32 { begin_datagram(content, 4) as i32 } + +pub fn solve_part2(content: &str) -> i32 { + begin_datagram(content, 14) as i32 +} From ce2778a09f0ad2abdce33b7bb68d481d81067a85 Mon Sep 17 00:00:00 2001 From: Florent DENEF Date: Thu, 2 Mar 2023 10:33:35 +0100 Subject: [PATCH 06/19] Simple reformat --- src/lib.rs | 5 ++--- src/prob4/mod.rs | 18 ++++++------------ 2 files changed, 8 insertions(+), 15 deletions(-) diff --git a/src/lib.rs b/src/lib.rs index 5762b5f..ed07268 100644 --- a/src/lib.rs +++ b/src/lib.rs @@ -1,8 +1,7 @@ -extern crate core; - pub mod prob1; pub mod prob2; pub mod prob3; pub mod prob4; pub mod prob5; -pub mod prob6; \ No newline at end of file +pub mod prob6; +pub mod prob7; diff --git a/src/prob4/mod.rs b/src/prob4/mod.rs index 35e3b3e..f1ea45c 100644 --- a/src/prob4/mod.rs +++ b/src/prob4/mod.rs @@ -11,37 +11,31 @@ pub fn complete_overlap(first_pair: &[u32], second_pair: &[u32]) -> bool { pub fn solve(file_path: &str, unary_operator: &dyn Fn(&[u32], &[u32]) -> bool) -> i32 { std::fs::read_to_string(file_path) - .expect("Please provide a text file as an argument.") + .unwrap_or_else(|err| panic!("Please provide a text file as an argument: {err}")) .lines() .map(|line| { let tmp = line.split(',').collect::>(); let first_pair = tmp .first() - .expect("First character error") + .unwrap_or_else(|| panic!("First character error")) .split('-') .map(|first_split| { first_split .parse::() - .expect("Parsing number in first pair failed") + .unwrap_or_else(|err| panic!("Parsing number in first pair failed: {err}")) }) .collect::>(); let second_pair = tmp .last() - .expect("First character error") + .unwrap_or_else(|| panic!("First character error")) .split('-') .map(|first_split| { first_split .parse::() - .expect("Parsing number in first pair failed") + .unwrap_or_else(|err| panic!("Parsing number in first pair failed: {err}")) }) .collect::>(); - if unary_operator(&first_pair, &second_pair) { - 1 - } else { - 0 - } + i32::from(unary_operator(&first_pair, &second_pair)) }) - .collect::>() - .iter() .sum() } \ No newline at end of file From 17740888b585e7dd98c835500a46d394454886f5 Mon Sep 17 00:00:00 2001 From: Florent DENEF Date: Thu, 2 Mar 2023 10:33:47 +0100 Subject: [PATCH 07/19] Adding prob7, unfinished. --- prob7.txt | 1027 ++++++++++++++++++++++++++++++++++++++++++++++++++ src/prob7.rs | 17 + 2 files changed, 1044 insertions(+) create mode 100644 prob7.txt create mode 100644 src/prob7.rs diff --git a/prob7.txt b/prob7.txt new file mode 100644 index 0000000..27eadd0 --- /dev/null +++ b/prob7.txt @@ -0,0 +1,1027 @@ +$ cd / +$ ls +268495 jgfbgjdb +dir ltcqgnc +272455 pct.bbd +200036 phthcq +174378 qld +dir rbmstsf +130541 trhbvp.fmm +dir twjcmp +$ cd ltcqgnc +$ ls +227634 brjmpbfg.hjh +dir cmdzcq +dir dnbf +203609 fpj +dir frt +288222 lcr.nlr +dir ngm +dir ngsrlzc +5927 phrnnw.dzj +dir shjv +dir wsvfbb +$ cd cmdzcq +$ ls +37316 cfvhc.qsw +41839 mgwlr +dir pfmbt +281659 tlpqzz +dir vmd +189667 zdvj.sbl +$ cd pfmbt +$ ls +120151 bhzsnw.gft +45035 cfvhc.zpp +$ cd .. +$ cd vmd +$ ls +dir dnc +dir rgftffp +$ cd dnc +$ ls +dir dvndwjzs +216199 fzwrr.ndp +dir gwhtzlpg +dir lsfn +dir lzcv +237080 qld +131509 rwhffw.ldj +84024 wph +$ cd dvndwjzs +$ ls +264750 htjvzrv.plg +$ cd .. +$ cd gwhtzlpg +$ ls +dir cfvhc +285900 fpj +112604 gqng.zww +188180 phthcq +dir prgbvj +$ cd cfvhc +$ ls +136528 bbsmm +$ cd .. +$ cd prgbvj +$ ls +180538 hfgg.fbm +$ cd .. +$ cd .. +$ cd lsfn +$ ls +133375 fzwrr.ndp +242940 gcftj.nlb +$ cd .. +$ cd lzcv +$ ls +121565 plnqnqq.zwr +100302 wdmqc +$ cd .. +$ cd .. +$ cd rgftffp +$ ls +259406 rwhffw +$ cd .. +$ cd .. +$ cd .. +$ cd dnbf +$ ls +dir bft +219468 czjvl.brj +130503 fpj +120522 rwhffw.hrn +92338 sngz.qsd +dir vpmvnmfj +$ cd bft +$ ls +dir zdvj +$ cd zdvj +$ ls +50020 sngz.qsd +$ cd .. +$ cd .. +$ cd vpmvnmfj +$ ls +78395 dlch.vfb +270867 hnmq +172551 pct.bbd +186790 phthcq +65750 sjjlnf.bjn +$ cd .. +$ cd .. +$ cd frt +$ ls +dir bbsmm +dir cfvhc +22983 dpvmzlv +dir fptlqh +290097 fzwrr.ndp +dir hvwdzbsw +dir nlm +57046 pct.bbd +208565 qld.mms +261556 wcfvpmz +$ cd bbsmm +$ ls +dir bbsmm +238522 hmjvg.pfn +228873 nvvsml.bcg +dir rwhffw +dir sgbnzbqt +$ cd bbsmm +$ ls +dir lnz +dir msmpndgh +dir ncpbn +dir wfr +$ cd lnz +$ ls +99970 fjbmpmrz.ldw +$ cd .. +$ cd msmpndgh +$ ls +dir sfsqwrhg +$ cd sfsqwrhg +$ ls +dir vfqg +$ cd vfqg +$ ls +17855 bbsmm +$ cd .. +$ cd .. +$ cd .. +$ cd ncpbn +$ ls +dir nltglc +$ cd nltglc +$ ls +247577 qld.vjz +$ cd .. +$ cd .. +$ cd wfr +$ ls +135424 bbps +243274 hsvjddff.nfw +dir prg +158111 qld.zff +dir rwhffw +$ cd prg +$ ls +214834 lfpqlt.bdt +dir nclpwh +104870 phthcq +dir trrtpgd +$ cd nclpwh +$ ls +104441 mjjftn.sqt +$ cd .. +$ cd trrtpgd +$ ls +137542 qld +$ cd .. +$ cd .. +$ cd rwhffw +$ ls +dir glsrf +$ cd glsrf +$ ls +189772 phthcq +$ cd .. +$ cd .. +$ cd .. +$ cd .. +$ cd rwhffw +$ ls +dir bbsmm +$ cd bbsmm +$ ls +104690 cfvhc.nwc +$ cd .. +$ cd .. +$ cd sgbnzbqt +$ ls +191204 cfvhc.jnv +127263 vwfbr +$ cd .. +$ cd .. +$ cd cfvhc +$ ls +72894 bbsmm.dns +$ cd .. +$ cd fptlqh +$ ls +dir bbsmm +dir bdvp +162052 vnnjfh.stw +dir zshvq +$ cd bbsmm +$ ls +dir bbsmm +dir pchdq +dir rwhffw +$ cd bbsmm +$ ls +174590 bbsmm +45636 fpj +102831 qld +dir vpwcmgq +229136 zdvj.rtw +dir znw +$ cd vpwcmgq +$ ls +dir cfvhc +dir jvd +dir zdvj +$ cd cfvhc +$ ls +55907 ccvdlc +272581 fpj +29765 phthcq +$ cd .. +$ cd jvd +$ ls +dir cfvhc +$ cd cfvhc +$ ls +289471 cjzwdvs.gtn +$ cd .. +$ cd .. +$ cd zdvj +$ ls +98507 cmldvpnc.qtl +$ cd .. +$ cd .. +$ cd znw +$ ls +dir zdvj +$ cd zdvj +$ ls +46012 wrgvln.lmf +$ cd .. +$ cd .. +$ cd .. +$ cd pchdq +$ ls +dir cbssm +98102 cfvhc +259488 pct.bbd +dir rwhffw +7541 sngz.qsd +167971 wvgrzn.bds +$ cd cbssm +$ ls +45025 bbsmm +22500 fpj +$ cd .. +$ cd rwhffw +$ ls +dir fncszbm +166012 phthcq +165925 rbs +171350 tsbv.zws +$ cd fncszbm +$ ls +dir wzrlzvm +$ cd wzrlzvm +$ ls +191811 qzzs +$ cd .. +$ cd .. +$ cd .. +$ cd .. +$ cd rwhffw +$ ls +218844 dnbmcbr.wrc +201091 mmpvsgjv.wgs +dir mzt +223628 pct.bbd +dir qftlpdt +56441 sngz.qsd +33730 zdvj.jfs +$ cd mzt +$ ls +25768 sngz.qsd +283843 vjrmbw.jcs +$ cd .. +$ cd qftlpdt +$ ls +287536 mzhmjrg +223797 pcp +$ cd .. +$ cd .. +$ cd .. +$ cd bdvp +$ ls +dir lnvvwlm +$ cd lnvvwlm +$ ls +210345 zll.scl +$ cd .. +$ cd .. +$ cd zshvq +$ ls +251997 cfvhc.mcr +220501 pct.bbd +$ cd .. +$ cd .. +$ cd hvwdzbsw +$ ls +dir cfvhc +21816 fpj +251732 vcfcwjh.pjh +187137 zdvj.bzd +dir zgprrg +$ cd cfvhc +$ ls +99722 zgq.bbh +$ cd .. +$ cd zgprrg +$ ls +dir brzpsnjl +$ cd brzpsnjl +$ ls +dir qld +$ cd qld +$ ls +30055 phqdjs.zwv +$ cd .. +$ cd .. +$ cd .. +$ cd .. +$ cd nlm +$ ls +176700 fzwrr.ndp +256184 pct.bbd +25442 qhngw.jwm +dir rwhffw +160900 wqr.wdn +$ cd rwhffw +$ ls +240085 pcjjgjcr +$ cd .. +$ cd .. +$ cd .. +$ cd ngm +$ ls +118461 bbsmm +dir czjzwl +dir gjwws +43114 nwvltczv.jpf +dir qjpgzsj +145909 rjdzrjzc.fdr +dir tvmpgrq +75554 zdmfhpwz.rhc +dir zdvj +196704 zdvj.nfm +$ cd czjzwl +$ ls +dir btnsjtl +dir cfvhc +100911 cfvhc.mqg +dir gljbgjq +247017 jmrq +dir qld +$ cd btnsjtl +$ ls +76658 pmgnqr +$ cd .. +$ cd cfvhc +$ ls +189214 jvrcttm +265333 mmgd.sbn +$ cd .. +$ cd gljbgjq +$ ls +dir ccqsnp +dir fng +104525 fzwrr.ndp +31517 gmqhmwj.rbs +122232 htddmr.wjm +51362 rtlnr.mwh +42769 rvddl +$ cd ccqsnp +$ ls +192021 cfvhc.lww +dir mbmsfgtb +222388 nvgppmv +dir qbpnbsv +$ cd mbmsfgtb +$ ls +104492 jfwl.jlv +273739 phthcq +238815 rwhffw.tjp +$ cd .. +$ cd qbpnbsv +$ ls +176577 tlqnmmsc.gpt +$ cd .. +$ cd .. +$ cd fng +$ ls +243298 cfvhc.pvb +54364 fbrtb.hqd +dir hvhwh +dir rtcsp +$ cd hvhwh +$ ls +87079 zdvj.gfq +$ cd .. +$ cd rtcsp +$ ls +dir zdvj +$ cd zdvj +$ ls +288617 rwhffw.lzl +161000 sngz.qsd +$ cd .. +$ cd .. +$ cd .. +$ cd .. +$ cd qld +$ ls +113942 bbsmm.msn +239442 cchgv.mtd +181920 nnlfh.gwz +274766 rqtvc.frp +$ cd .. +$ cd .. +$ cd gjwws +$ ls +dir bpzsc +dir cfvhc +dir fsnf +dir zdvj +$ cd bpzsc +$ ls +88033 cndwmvj.pzm +275297 hslg.smz +dir qld +25067 qvntlcd.nzs +$ cd qld +$ ls +240593 bbsmm.bgn +dir dpqgcc +277540 fpj +dir qld +$ cd dpqgcc +$ ls +dir rhqvcfd +$ cd rhqvcfd +$ ls +199386 fzwrr.ndp +$ cd .. +$ cd .. +$ cd qld +$ ls +269177 cjrc.dvq +21631 fpj +263874 pct.bbd +$ cd .. +$ cd .. +$ cd .. +$ cd cfvhc +$ ls +dir nzd +$ cd nzd +$ ls +273225 qld.jmn +$ cd .. +$ cd .. +$ cd fsnf +$ ls +17887 fzwrr.ndp +$ cd .. +$ cd zdvj +$ ls +160076 rwhffw.trf +$ cd .. +$ cd .. +$ cd qjpgzsj +$ ls +227586 njqbnz.hwl +239840 zdvj.qcp +$ cd .. +$ cd tvmpgrq +$ ls +dir hdrsmnvc +dir psrjr +$ cd hdrsmnvc +$ ls +dir rjm +dir zdvj +$ cd rjm +$ ls +244666 bzvmdcm +$ cd .. +$ cd zdvj +$ ls +132943 gnz.ntd +$ cd .. +$ cd .. +$ cd psrjr +$ ls +dir nfvllp +dir plfgfs +94173 qmdhr +3133 swjh.rbg +dir zmp +$ cd nfvllp +$ ls +39707 zbsm.vsd +$ cd .. +$ cd plfgfs +$ ls +186603 cfvhc.sgb +183833 ljn +$ cd .. +$ cd zmp +$ ls +123313 fzwrr.ndp +$ cd .. +$ cd .. +$ cd .. +$ cd zdvj +$ ls +dir hzzs +230054 nhcvn.dfl +dir rgwfsqdc +dir zwtjr +$ cd hzzs +$ ls +58585 cbfhrf.vqn +dir cfvhc +dir fbzpmc +dir fdtjp +28182 fzwrr.ndp +35581 nzwndl.zzs +dir pmrv +253508 qgdnnl.tqq +$ cd cfvhc +$ ls +256186 nlgzqw.frl +$ cd .. +$ cd fbzpmc +$ ls +dir cfvhc +$ cd cfvhc +$ ls +193322 rwhffw.vwc +$ cd .. +$ cd .. +$ cd fdtjp +$ ls +dir bbsmm +140927 fzwrr.ndp +dir lcmpbs +94413 mpnfgpsm +dir qvrd +247202 tlp +$ cd bbsmm +$ ls +206896 clsqp.hbr +$ cd .. +$ cd lcmpbs +$ ls +dir bbsmm +dir cfvhc +dir rplqgm +dir tmh +dir zdvj +$ cd bbsmm +$ ls +235479 sngz.qsd +$ cd .. +$ cd cfvhc +$ ls +285029 fpj +29405 mhpr.czj +$ cd .. +$ cd rplqgm +$ ls +dir bbsmm +dir cfvhc +dir mwhf +$ cd bbsmm +$ ls +257187 hsldvt.jdt +186098 pct.bbd +$ cd .. +$ cd cfvhc +$ ls +dir rfw +$ cd rfw +$ ls +254454 fzf.ltl +$ cd .. +$ cd .. +$ cd mwhf +$ ls +3915 dtcjptnd +116218 fzwrr.ndp +$ cd .. +$ cd .. +$ cd tmh +$ ls +49016 ljsvgl.npd +258257 mlfq.rrr +$ cd .. +$ cd zdvj +$ ls +dir jjj +154441 lcpvwhp.mpq +$ cd jjj +$ ls +31731 bbsmm.mhb +$ cd .. +$ cd .. +$ cd .. +$ cd qvrd +$ ls +199473 pgqbpq +$ cd .. +$ cd .. +$ cd pmrv +$ ls +120831 cfvhc.btv +$ cd .. +$ cd .. +$ cd rgwfsqdc +$ ls +281099 cfvhc.trc +119483 mntqrvw.qwz +275572 zhphps +$ cd .. +$ cd zwtjr +$ ls +187404 gwjsj +230074 qmr +212641 wdhl.dfl +$ cd .. +$ cd .. +$ cd .. +$ cd ngsrlzc +$ ls +164729 lnc.mdg +33748 pct.bbd +119803 rfst.blw +dir zdvj +$ cd zdvj +$ ls +dir bbsmm +251550 sngz.qsd +120940 zlmcvg +$ cd bbsmm +$ ls +206509 bsddjdv +$ cd .. +$ cd .. +$ cd .. +$ cd shjv +$ ls +17754 lqqz.qmf +265175 rdmsqztj.lnt +$ cd .. +$ cd wsvfbb +$ ls +dir bhbb +271856 fzwrr.ndp +114188 hgfjq.jvn +dir jgnl +dir qnddp +51700 rwdnzwhv.vtr +$ cd bhbb +$ ls +107036 rwhffw.pld +$ cd .. +$ cd jgnl +$ ls +dir qld +$ cd qld +$ ls +39294 rbsvwh +$ cd .. +$ cd .. +$ cd qnddp +$ ls +dir vzmrb +58723 wcbz.dwh +$ cd vzmrb +$ ls +203361 rvrbgd.cpw +167876 zgpdcb.rql +$ cd .. +$ cd .. +$ cd .. +$ cd .. +$ cd rbmstsf +$ ls +dir bbsmm +dir cfvhc +63250 hcdlfmt.ccg +dir mgzl +dir ngflwbmp +dir shvjprl +123258 spqchmj.wpv +$ cd bbsmm +$ ls +dir cfvhc +dir gtvszgs +6558 nzdhg +121160 qld +dir rfjfp +dir rwhffw +dir sbfshph +$ cd cfvhc +$ ls +dir btmbjrw +dir pzq +133178 sngz.qsd +$ cd btmbjrw +$ ls +dir ftpvz +dir tjflfshs +dir wvncjmf +$ cd ftpvz +$ ls +dir lqlrh +$ cd lqlrh +$ ls +114380 pcn.cbn +$ cd .. +$ cd .. +$ cd tjflfshs +$ ls +274555 bbsmm.wpr +$ cd .. +$ cd wvncjmf +$ ls +dir nnrqcfmm +$ cd nnrqcfmm +$ ls +217188 pct.bbd +$ cd .. +$ cd .. +$ cd .. +$ cd pzq +$ ls +89797 sngz.qsd +255100 thg +$ cd .. +$ cd .. +$ cd gtvszgs +$ ls +87661 sngz.qsd +$ cd .. +$ cd rfjfp +$ ls +130164 cfvhc.rbt +dir lhf +dir qld +20799 qld.gts +dir qwzj +150977 sngz.qsd +$ cd lhf +$ ls +125848 lvgv.jtg +81087 mdcw.rbv +80091 qld +dir rmsggp +49093 thf.jnh +dir tmf +dir zdvj +$ cd rmsggp +$ ls +dir fznsmbq +dir lhghnn +dir zdvj +$ cd fznsmbq +$ ls +dir wqzwsspq +dir zdvj +$ cd wqzwsspq +$ ls +dir gbzfpfq +$ cd gbzfpfq +$ ls +185410 pct.bbd +$ cd .. +$ cd .. +$ cd zdvj +$ ls +140384 pct.bbd +$ cd .. +$ cd .. +$ cd lhghnn +$ ls +36868 fpj +181925 pct.bbd +$ cd .. +$ cd zdvj +$ ls +256916 bbsmm.mtr +dir rwhffw +75846 rwztfcj.qns +$ cd rwhffw +$ ls +234834 bbsmm.gtp +140315 pbwqrps +$ cd .. +$ cd .. +$ cd .. +$ cd tmf +$ ls +88583 dhndg +52796 qld.mlp +$ cd .. +$ cd zdvj +$ ls +8822 pct.bbd +221658 sngz.qsd +$ cd .. +$ cd .. +$ cd qld +$ ls +119026 dfc.bgr +87684 fzwrr.ndp +dir zdvj +212120 zdvj.jhw +$ cd zdvj +$ ls +dir cfvhc +169434 mhlpvf.vjz +$ cd cfvhc +$ ls +243919 brtvv +$ cd .. +$ cd .. +$ cd .. +$ cd qwzj +$ ls +101395 qcjvs.mjs +$ cd .. +$ cd .. +$ cd rwhffw +$ ls +94012 fzwrr.ndp +205816 hqrgfm.wwt +dir lzbmzw +155203 qjv +$ cd lzbmzw +$ ls +dir dfrdczdj +$ cd dfrdczdj +$ ls +126459 tphtshwc +$ cd .. +$ cd .. +$ cd .. +$ cd sbfshph +$ ls +229389 ccbgcv +135997 cfvhc.ctl +119490 rwhffw.pqp +94530 vjtjz.cfs +$ cd .. +$ cd .. +$ cd cfvhc +$ ls +dir cmr +dir jvh +dir mjs +$ cd cmr +$ ls +227026 fpj +$ cd .. +$ cd jvh +$ ls +dir qld +$ cd qld +$ ls +96968 phthcq +$ cd .. +$ cd .. +$ cd mjs +$ ls +98117 qld.ftd +$ cd .. +$ cd .. +$ cd mgzl +$ ls +198793 nfvnfqn.zwd +$ cd .. +$ cd ngflwbmp +$ ls +dir bbsmm +dir jthnmqs +137176 nrn +80344 ntbq.ssw +133166 phthcq +210691 sngz.qsd +255501 vgwn.gqr +dir zdvj +$ cd bbsmm +$ ls +98501 npwwzjgt +134593 sngz.qsd +46020 tjszcpm.brs +213591 zdvj.sgj +$ cd .. +$ cd jthnmqs +$ ls +dir bbsmm +dir cfdbp +dir dpwqmbw +67233 lzz.tmg +21344 pzvjlt.qdb +dir rwhffw +dir sdtntw +268059 vwhqh +dir zdvj +$ cd bbsmm +$ ls +263767 fpj +46528 tpq.wtb +$ cd .. +$ cd cfdbp +$ ls +dir grczc +$ cd grczc +$ ls +241829 vnnjnz.nww +$ cd .. +$ cd .. +$ cd dpwqmbw +$ ls +287899 pct.bbd +$ cd .. +$ cd rwhffw +$ ls +41741 ffsqr.cwc +dir ffzc +dir nrs +279620 qchg +$ cd ffzc +$ ls +10583 pct.bbd +$ cd .. +$ cd nrs +$ ls +195239 zdvj.npp +$ cd .. +$ cd .. +$ cd sdtntw +$ ls +245601 fpj +9552 lgftw.ntj +$ cd .. +$ cd zdvj +$ ls +dir smjvcql +$ cd smjvcql +$ ls +dir qcqljj +$ cd qcqljj +$ ls +286791 fhm +$ cd .. +$ cd .. +$ cd .. +$ cd .. +$ cd zdvj +$ ls +dir bcghd +57663 fzwrr.ndp +177473 gzpfmsz.tnw +53543 pswpr +251188 sngz.qsd +dir snqjl +$ cd bcghd +$ ls +106732 sjvhjd +dir vtgsnb +$ cd vtgsnb +$ ls +dir gtj +$ cd gtj +$ ls +151689 nncsjvn.vhd +$ cd .. +$ cd .. +$ cd .. +$ cd snqjl +$ ls +104993 bjjqd.pqv +233367 fzwrr.ndp +11942 sngz.qsd +$ cd .. +$ cd .. +$ cd .. +$ cd shvjprl +$ ls +130539 jpzsdjw.hlz +$ cd .. +$ cd .. +$ cd twjcmp +$ ls +86053 pct.bbd \ No newline at end of file diff --git a/src/prob7.rs b/src/prob7.rs new file mode 100644 index 0000000..24c01dc --- /dev/null +++ b/src/prob7.rs @@ -0,0 +1,17 @@ +use nom::{branch::alt, bytes::complete::tag, combinator::map, IResult}; + +use crate::prob7::Instructions::{Cd, Dir, Ls}; + +enum Instructions { + Ls, + Cd, + Dir, +} + +fn parse_instruction(i: &str) -> IResult<&str, Instructions> { + alt(( + map(tag("ls"), |_| Ls), + map(tag("cd"), |_| Cd), + map(tag("dir"), |_| Dir), + ))(i) +} From 62bba8037860a54be2274ff14fdd17f03d494550 Mon Sep 17 00:00:00 2001 From: Pcornat Date: Wed, 20 Sep 2023 19:25:11 +0200 Subject: [PATCH 08/19] Prob7 using parser from the same site for solution. --- Cargo.toml | 1 + src/prob7.rs | 106 +++++++++++++++++++++++++++++++++++++++++++++------ 2 files changed, 96 insertions(+), 11 deletions(-) diff --git a/Cargo.toml b/Cargo.toml index bf7e11d..888dc55 100644 --- a/Cargo.toml +++ b/Cargo.toml @@ -13,3 +13,4 @@ rpath = true [dependencies] nom = "7.1.1" itertools = "0.10.5" +camino = "1.1.6" diff --git a/src/prob7.rs b/src/prob7.rs index 24c01dc..c55f7e0 100644 --- a/src/prob7.rs +++ b/src/prob7.rs @@ -1,17 +1,101 @@ -use nom::{branch::alt, bytes::complete::tag, combinator::map, IResult}; +use std::collections::HashMap; -use crate::prob7::Instructions::{Cd, Dir, Ls}; +use camino::Utf8PathBuf; +use nom::combinator::all_consuming; +use nom::{ + branch::alt, + bytes::complete::{tag, take_while1}, + combinator::map, + sequence::{preceded, separated_pair}, + Finish, IResult, +}; -enum Instructions { +#[derive(Debug)] +struct Ls; + +#[derive(Debug)] +struct Cd(Utf8PathBuf); + +#[derive(Debug)] +enum Entry { + Dir(Utf8PathBuf), + File(u64, Utf8PathBuf), +} + +#[derive(Debug)] +enum Command { Ls, - Cd, - Dir, + Cd(Utf8PathBuf), } -fn parse_instruction(i: &str) -> IResult<&str, Instructions> { - alt(( - map(tag("ls"), |_| Ls), - map(tag("cd"), |_| Cd), - map(tag("dir"), |_| Dir), - ))(i) +#[derive(Debug)] +enum Line { + Command(Command), + Entry(Entry), +} + +impl From for Command { + fn from(_ls: Ls) -> Self { + Command::Ls + } +} + +impl From for Command { + fn from(cd: Cd) -> Self { + Command::Cd(cd.0) + } +} + +struct Node { + children: HashMap, + size: u32, +} + +fn parse_entry(input: &str) -> IResult<&str, Entry> { + let parse_file = map( + separated_pair(nom::character::complete::u64, tag(" "), parse_path), + |(size, path)| Entry::File(size, path), + ); + let parse_dir = map(preceded(tag("dir "), parse_path), Entry::Dir); + + alt((parse_file, parse_dir))(input) +} + +fn parse_path(input: &str) -> IResult<&str, Utf8PathBuf> { + map( + take_while1(|c: char| "abcdefghijklmnopqrstuvwxyz./".contains(c)), + Into::into, + )(input) +} + +fn parse_ls(input: &str) -> IResult<&str, Ls> { + map(tag("ls"), |_| Ls)(input) +} +fn parse_cd(input: &str) -> IResult<&str, Cd> { + map(preceded(tag("cd "), parse_path), Cd)(input) +} + +fn parse_command(line: &str) -> IResult<&str, Command> { + let (input, _) = tag("$ ")(line)?; + alt((map(parse_ls, Into::into), map(parse_cd, Into::into)))(input) +} + +fn parse_line(input: &str) -> IResult<&str, Line> { + alt(( + map(parse_command, Line::Command), + map(parse_entry, Line::Entry), + ))(input) +} + +pub fn solve_part1(content: &str) { + let lines = content.lines().map(|line| { + all_consuming(parse_line)(line) + .finish() + .unwrap_or_else(|err| panic!("{err}")) + .1 + }); + + for line in lines { + println!("{line:?}"); + } } From b2d66319e377f302b8f4f0564f7fa5144557eeff Mon Sep 17 00:00:00 2001 From: Pcornat Date: Wed, 20 Sep 2023 19:46:57 +0200 Subject: [PATCH 09/19] Adding id_tree and color_eyre. id_tree is used for arbitrary trees of any number of child per node. color_eyre is for better error output handling --- Cargo.toml | 4 +++- 1 file changed, 3 insertions(+), 1 deletion(-) diff --git a/Cargo.toml b/Cargo.toml index 888dc55..bfa6921 100644 --- a/Cargo.toml +++ b/Cargo.toml @@ -12,5 +12,7 @@ rpath = true [dependencies] nom = "7.1.1" -itertools = "0.10.5" +itertools = "0.11.0" camino = "1.1.6" +id_tree = "1.8.0" +color-eyre = "0.6.2" From 3a3f62148b1a696160ae5c0a90ca0cbfa42b729d Mon Sep 17 00:00:00 2001 From: Pcornat Date: Wed, 20 Sep 2023 20:27:39 +0200 Subject: [PATCH 10/19] Solved day 7 part 1 --- src/main.rs | 12 +++++++-- src/prob7.rs | 74 ++++++++++++++++++++++++++++++++++++++++++++++------ 2 files changed, 76 insertions(+), 10 deletions(-) diff --git a/src/main.rs b/src/main.rs index 697cdec..8c700eb 100644 --- a/src/main.rs +++ b/src/main.rs @@ -1,6 +1,8 @@ -use advent_of_code::{prob1, prob2, prob3, prob4, prob5, prob6}; +use advent_of_code::{prob1, prob2, prob3, prob4, prob5, prob6, prob7}; +use color_eyre::eyre::Result; -fn main() { +fn main() -> Result<()> { + color_eyre::install()?; { let file_path = "prob1.txt"; let max_part1 = prob1::solve_part1(file_path); @@ -53,4 +55,10 @@ fn main() { let solution = prob6::solve_part2(include_str!("../prob6_part1.txt")); println!("Solution for problem 6 part 2: {solution}"); } + { + let _file_path = "prob7.txt"; + let solution = prob7::solve_part1(include_str!("../prob7.txt"))?; + println!("Solution for problem 7 part 1: {solution}"); + } + Ok(()) } diff --git a/src/prob7.rs b/src/prob7.rs index c55f7e0..6cf4dac 100644 --- a/src/prob7.rs +++ b/src/prob7.rs @@ -1,11 +1,9 @@ -use std::collections::HashMap; - use camino::Utf8PathBuf; -use nom::combinator::all_consuming; +use id_tree::{InsertBehavior, Node, Tree}; use nom::{ branch::alt, bytes::complete::{tag, take_while1}, - combinator::map, + combinator::{all_consuming, map}, sequence::{preceded, separated_pair}, Finish, IResult, }; @@ -46,9 +44,10 @@ impl From for Command { } } -struct Node { - children: HashMap, - size: u32, +#[derive(Debug, Default)] +struct FsEntry { + path: Utf8PathBuf, + size: u64, } fn parse_entry(input: &str) -> IResult<&str, Entry> { @@ -87,7 +86,15 @@ fn parse_line(input: &str) -> IResult<&str, Line> { ))(input) } -pub fn solve_part1(content: &str) { +fn total_size(tree: &Tree, node: &Node) -> color_eyre::Result { + let mut total = node.data().size; + for child in node.children() { + total += total_size(tree, tree.get(child)?)?; + } + Ok(total) +} + +fn generate_tree(content: &str) -> color_eyre::Result> { let lines = content.lines().map(|line| { all_consuming(parse_line)(line) .finish() @@ -95,7 +102,58 @@ pub fn solve_part1(content: &str) { .1 }); + let mut tree = Tree::::new(); + let root = tree.insert( + Node::new(FsEntry { + path: "/".into(), + size: 0, + }), + InsertBehavior::AsRoot, + )?; + let mut curr = root; + for line in lines { println!("{line:?}"); + match line { + Line::Command(cmd) => match cmd { + Command::Ls => {} + Command::Cd(path) => match path.as_str() { + "/" => {} + ".." => { + curr = tree.get(&curr)?.parent().unwrap().clone(); + } + _ => { + curr = tree.insert( + Node::new(FsEntry { + path: path.clone(), + size: 0, + }), + InsertBehavior::UnderNode(&curr), + )?; + } + }, + }, + Line::Entry(entry) => match entry { + Entry::Dir(_) => {} + Entry::File(size, name) => { + curr = tree.insert( + Node::new(FsEntry { path: name, size }), + InsertBehavior::UnderNode(&curr), + )?; + } + }, + } } + Ok(tree) +} + +pub fn solve_part1(content: &str) -> color_eyre::Result { + let tree = generate_tree(content)?; + let sum = tree + .traverse_pre_order(tree.root_node_id().unwrap())? + .filter(|n| !n.children().is_empty()) + .map(|n| total_size(&tree, n).unwrap()) + .filter(|&s| s <= 100_000) + .sum::(); + Ok(sum) } From 9a5252b6352f4221cf0df7dc2f2ecc3c1b45d7b7 Mon Sep 17 00:00:00 2001 From: Pcornat Date: Wed, 20 Sep 2023 20:52:01 +0200 Subject: [PATCH 11/19] Solved day 7 part 1 --- prob7.txt => prob7_part1.txt | 0 src/main.rs | 4 ++-- 2 files changed, 2 insertions(+), 2 deletions(-) rename prob7.txt => prob7_part1.txt (100%) diff --git a/prob7.txt b/prob7_part1.txt similarity index 100% rename from prob7.txt rename to prob7_part1.txt diff --git a/src/main.rs b/src/main.rs index 8c700eb..5f814a2 100644 --- a/src/main.rs +++ b/src/main.rs @@ -56,8 +56,8 @@ fn main() -> Result<()> { println!("Solution for problem 6 part 2: {solution}"); } { - let _file_path = "prob7.txt"; - let solution = prob7::solve_part1(include_str!("../prob7.txt"))?; + let _file_path = "prob7_part1.txt"; + let solution = prob7::solve_part1(include_str!("../prob7_part1.txt"))?; println!("Solution for problem 7 part 1: {solution}"); } Ok(()) From 0ee7c433e3f94d281d52fdbc52e211211746a051 Mon Sep 17 00:00:00 2001 From: Pcornat Date: Wed, 20 Sep 2023 20:53:10 +0200 Subject: [PATCH 12/19] Solved day 7 part 2 --- prob7_part2.txt | 1027 +++++++++++++++++++++++++++++++++++++++++++++++ src/main.rs | 4 + src/prob7.rs | 20 +- 3 files changed, 1049 insertions(+), 2 deletions(-) create mode 100644 prob7_part2.txt diff --git a/prob7_part2.txt b/prob7_part2.txt new file mode 100644 index 0000000..27eadd0 --- /dev/null +++ b/prob7_part2.txt @@ -0,0 +1,1027 @@ +$ cd / +$ ls +268495 jgfbgjdb +dir ltcqgnc +272455 pct.bbd +200036 phthcq +174378 qld +dir rbmstsf +130541 trhbvp.fmm +dir twjcmp +$ cd ltcqgnc +$ ls +227634 brjmpbfg.hjh +dir cmdzcq +dir dnbf +203609 fpj +dir frt +288222 lcr.nlr +dir ngm +dir ngsrlzc +5927 phrnnw.dzj +dir shjv +dir wsvfbb +$ cd cmdzcq +$ ls +37316 cfvhc.qsw +41839 mgwlr +dir pfmbt +281659 tlpqzz +dir vmd +189667 zdvj.sbl +$ cd pfmbt +$ ls +120151 bhzsnw.gft +45035 cfvhc.zpp +$ cd .. +$ cd vmd +$ ls +dir dnc +dir rgftffp +$ cd dnc +$ ls +dir dvndwjzs +216199 fzwrr.ndp +dir gwhtzlpg +dir lsfn +dir lzcv +237080 qld +131509 rwhffw.ldj +84024 wph +$ cd dvndwjzs +$ ls +264750 htjvzrv.plg +$ cd .. +$ cd gwhtzlpg +$ ls +dir cfvhc +285900 fpj +112604 gqng.zww +188180 phthcq +dir prgbvj +$ cd cfvhc +$ ls +136528 bbsmm +$ cd .. +$ cd prgbvj +$ ls +180538 hfgg.fbm +$ cd .. +$ cd .. +$ cd lsfn +$ ls +133375 fzwrr.ndp +242940 gcftj.nlb +$ cd .. +$ cd lzcv +$ ls +121565 plnqnqq.zwr +100302 wdmqc +$ cd .. +$ cd .. +$ cd rgftffp +$ ls +259406 rwhffw +$ cd .. +$ cd .. +$ cd .. +$ cd dnbf +$ ls +dir bft +219468 czjvl.brj +130503 fpj +120522 rwhffw.hrn +92338 sngz.qsd +dir vpmvnmfj +$ cd bft +$ ls +dir zdvj +$ cd zdvj +$ ls +50020 sngz.qsd +$ cd .. +$ cd .. +$ cd vpmvnmfj +$ ls +78395 dlch.vfb +270867 hnmq +172551 pct.bbd +186790 phthcq +65750 sjjlnf.bjn +$ cd .. +$ cd .. +$ cd frt +$ ls +dir bbsmm +dir cfvhc +22983 dpvmzlv +dir fptlqh +290097 fzwrr.ndp +dir hvwdzbsw +dir nlm +57046 pct.bbd +208565 qld.mms +261556 wcfvpmz +$ cd bbsmm +$ ls +dir bbsmm +238522 hmjvg.pfn +228873 nvvsml.bcg +dir rwhffw +dir sgbnzbqt +$ cd bbsmm +$ ls +dir lnz +dir msmpndgh +dir ncpbn +dir wfr +$ cd lnz +$ ls +99970 fjbmpmrz.ldw +$ cd .. +$ cd msmpndgh +$ ls +dir sfsqwrhg +$ cd sfsqwrhg +$ ls +dir vfqg +$ cd vfqg +$ ls +17855 bbsmm +$ cd .. +$ cd .. +$ cd .. +$ cd ncpbn +$ ls +dir nltglc +$ cd nltglc +$ ls +247577 qld.vjz +$ cd .. +$ cd .. +$ cd wfr +$ ls +135424 bbps +243274 hsvjddff.nfw +dir prg +158111 qld.zff +dir rwhffw +$ cd prg +$ ls +214834 lfpqlt.bdt +dir nclpwh +104870 phthcq +dir trrtpgd +$ cd nclpwh +$ ls +104441 mjjftn.sqt +$ cd .. +$ cd trrtpgd +$ ls +137542 qld +$ cd .. +$ cd .. +$ cd rwhffw +$ ls +dir glsrf +$ cd glsrf +$ ls +189772 phthcq +$ cd .. +$ cd .. +$ cd .. +$ cd .. +$ cd rwhffw +$ ls +dir bbsmm +$ cd bbsmm +$ ls +104690 cfvhc.nwc +$ cd .. +$ cd .. +$ cd sgbnzbqt +$ ls +191204 cfvhc.jnv +127263 vwfbr +$ cd .. +$ cd .. +$ cd cfvhc +$ ls +72894 bbsmm.dns +$ cd .. +$ cd fptlqh +$ ls +dir bbsmm +dir bdvp +162052 vnnjfh.stw +dir zshvq +$ cd bbsmm +$ ls +dir bbsmm +dir pchdq +dir rwhffw +$ cd bbsmm +$ ls +174590 bbsmm +45636 fpj +102831 qld +dir vpwcmgq +229136 zdvj.rtw +dir znw +$ cd vpwcmgq +$ ls +dir cfvhc +dir jvd +dir zdvj +$ cd cfvhc +$ ls +55907 ccvdlc +272581 fpj +29765 phthcq +$ cd .. +$ cd jvd +$ ls +dir cfvhc +$ cd cfvhc +$ ls +289471 cjzwdvs.gtn +$ cd .. +$ cd .. +$ cd zdvj +$ ls +98507 cmldvpnc.qtl +$ cd .. +$ cd .. +$ cd znw +$ ls +dir zdvj +$ cd zdvj +$ ls +46012 wrgvln.lmf +$ cd .. +$ cd .. +$ cd .. +$ cd pchdq +$ ls +dir cbssm +98102 cfvhc +259488 pct.bbd +dir rwhffw +7541 sngz.qsd +167971 wvgrzn.bds +$ cd cbssm +$ ls +45025 bbsmm +22500 fpj +$ cd .. +$ cd rwhffw +$ ls +dir fncszbm +166012 phthcq +165925 rbs +171350 tsbv.zws +$ cd fncszbm +$ ls +dir wzrlzvm +$ cd wzrlzvm +$ ls +191811 qzzs +$ cd .. +$ cd .. +$ cd .. +$ cd .. +$ cd rwhffw +$ ls +218844 dnbmcbr.wrc +201091 mmpvsgjv.wgs +dir mzt +223628 pct.bbd +dir qftlpdt +56441 sngz.qsd +33730 zdvj.jfs +$ cd mzt +$ ls +25768 sngz.qsd +283843 vjrmbw.jcs +$ cd .. +$ cd qftlpdt +$ ls +287536 mzhmjrg +223797 pcp +$ cd .. +$ cd .. +$ cd .. +$ cd bdvp +$ ls +dir lnvvwlm +$ cd lnvvwlm +$ ls +210345 zll.scl +$ cd .. +$ cd .. +$ cd zshvq +$ ls +251997 cfvhc.mcr +220501 pct.bbd +$ cd .. +$ cd .. +$ cd hvwdzbsw +$ ls +dir cfvhc +21816 fpj +251732 vcfcwjh.pjh +187137 zdvj.bzd +dir zgprrg +$ cd cfvhc +$ ls +99722 zgq.bbh +$ cd .. +$ cd zgprrg +$ ls +dir brzpsnjl +$ cd brzpsnjl +$ ls +dir qld +$ cd qld +$ ls +30055 phqdjs.zwv +$ cd .. +$ cd .. +$ cd .. +$ cd .. +$ cd nlm +$ ls +176700 fzwrr.ndp +256184 pct.bbd +25442 qhngw.jwm +dir rwhffw +160900 wqr.wdn +$ cd rwhffw +$ ls +240085 pcjjgjcr +$ cd .. +$ cd .. +$ cd .. +$ cd ngm +$ ls +118461 bbsmm +dir czjzwl +dir gjwws +43114 nwvltczv.jpf +dir qjpgzsj +145909 rjdzrjzc.fdr +dir tvmpgrq +75554 zdmfhpwz.rhc +dir zdvj +196704 zdvj.nfm +$ cd czjzwl +$ ls +dir btnsjtl +dir cfvhc +100911 cfvhc.mqg +dir gljbgjq +247017 jmrq +dir qld +$ cd btnsjtl +$ ls +76658 pmgnqr +$ cd .. +$ cd cfvhc +$ ls +189214 jvrcttm +265333 mmgd.sbn +$ cd .. +$ cd gljbgjq +$ ls +dir ccqsnp +dir fng +104525 fzwrr.ndp +31517 gmqhmwj.rbs +122232 htddmr.wjm +51362 rtlnr.mwh +42769 rvddl +$ cd ccqsnp +$ ls +192021 cfvhc.lww +dir mbmsfgtb +222388 nvgppmv +dir qbpnbsv +$ cd mbmsfgtb +$ ls +104492 jfwl.jlv +273739 phthcq +238815 rwhffw.tjp +$ cd .. +$ cd qbpnbsv +$ ls +176577 tlqnmmsc.gpt +$ cd .. +$ cd .. +$ cd fng +$ ls +243298 cfvhc.pvb +54364 fbrtb.hqd +dir hvhwh +dir rtcsp +$ cd hvhwh +$ ls +87079 zdvj.gfq +$ cd .. +$ cd rtcsp +$ ls +dir zdvj +$ cd zdvj +$ ls +288617 rwhffw.lzl +161000 sngz.qsd +$ cd .. +$ cd .. +$ cd .. +$ cd .. +$ cd qld +$ ls +113942 bbsmm.msn +239442 cchgv.mtd +181920 nnlfh.gwz +274766 rqtvc.frp +$ cd .. +$ cd .. +$ cd gjwws +$ ls +dir bpzsc +dir cfvhc +dir fsnf +dir zdvj +$ cd bpzsc +$ ls +88033 cndwmvj.pzm +275297 hslg.smz +dir qld +25067 qvntlcd.nzs +$ cd qld +$ ls +240593 bbsmm.bgn +dir dpqgcc +277540 fpj +dir qld +$ cd dpqgcc +$ ls +dir rhqvcfd +$ cd rhqvcfd +$ ls +199386 fzwrr.ndp +$ cd .. +$ cd .. +$ cd qld +$ ls +269177 cjrc.dvq +21631 fpj +263874 pct.bbd +$ cd .. +$ cd .. +$ cd .. +$ cd cfvhc +$ ls +dir nzd +$ cd nzd +$ ls +273225 qld.jmn +$ cd .. +$ cd .. +$ cd fsnf +$ ls +17887 fzwrr.ndp +$ cd .. +$ cd zdvj +$ ls +160076 rwhffw.trf +$ cd .. +$ cd .. +$ cd qjpgzsj +$ ls +227586 njqbnz.hwl +239840 zdvj.qcp +$ cd .. +$ cd tvmpgrq +$ ls +dir hdrsmnvc +dir psrjr +$ cd hdrsmnvc +$ ls +dir rjm +dir zdvj +$ cd rjm +$ ls +244666 bzvmdcm +$ cd .. +$ cd zdvj +$ ls +132943 gnz.ntd +$ cd .. +$ cd .. +$ cd psrjr +$ ls +dir nfvllp +dir plfgfs +94173 qmdhr +3133 swjh.rbg +dir zmp +$ cd nfvllp +$ ls +39707 zbsm.vsd +$ cd .. +$ cd plfgfs +$ ls +186603 cfvhc.sgb +183833 ljn +$ cd .. +$ cd zmp +$ ls +123313 fzwrr.ndp +$ cd .. +$ cd .. +$ cd .. +$ cd zdvj +$ ls +dir hzzs +230054 nhcvn.dfl +dir rgwfsqdc +dir zwtjr +$ cd hzzs +$ ls +58585 cbfhrf.vqn +dir cfvhc +dir fbzpmc +dir fdtjp +28182 fzwrr.ndp +35581 nzwndl.zzs +dir pmrv +253508 qgdnnl.tqq +$ cd cfvhc +$ ls +256186 nlgzqw.frl +$ cd .. +$ cd fbzpmc +$ ls +dir cfvhc +$ cd cfvhc +$ ls +193322 rwhffw.vwc +$ cd .. +$ cd .. +$ cd fdtjp +$ ls +dir bbsmm +140927 fzwrr.ndp +dir lcmpbs +94413 mpnfgpsm +dir qvrd +247202 tlp +$ cd bbsmm +$ ls +206896 clsqp.hbr +$ cd .. +$ cd lcmpbs +$ ls +dir bbsmm +dir cfvhc +dir rplqgm +dir tmh +dir zdvj +$ cd bbsmm +$ ls +235479 sngz.qsd +$ cd .. +$ cd cfvhc +$ ls +285029 fpj +29405 mhpr.czj +$ cd .. +$ cd rplqgm +$ ls +dir bbsmm +dir cfvhc +dir mwhf +$ cd bbsmm +$ ls +257187 hsldvt.jdt +186098 pct.bbd +$ cd .. +$ cd cfvhc +$ ls +dir rfw +$ cd rfw +$ ls +254454 fzf.ltl +$ cd .. +$ cd .. +$ cd mwhf +$ ls +3915 dtcjptnd +116218 fzwrr.ndp +$ cd .. +$ cd .. +$ cd tmh +$ ls +49016 ljsvgl.npd +258257 mlfq.rrr +$ cd .. +$ cd zdvj +$ ls +dir jjj +154441 lcpvwhp.mpq +$ cd jjj +$ ls +31731 bbsmm.mhb +$ cd .. +$ cd .. +$ cd .. +$ cd qvrd +$ ls +199473 pgqbpq +$ cd .. +$ cd .. +$ cd pmrv +$ ls +120831 cfvhc.btv +$ cd .. +$ cd .. +$ cd rgwfsqdc +$ ls +281099 cfvhc.trc +119483 mntqrvw.qwz +275572 zhphps +$ cd .. +$ cd zwtjr +$ ls +187404 gwjsj +230074 qmr +212641 wdhl.dfl +$ cd .. +$ cd .. +$ cd .. +$ cd ngsrlzc +$ ls +164729 lnc.mdg +33748 pct.bbd +119803 rfst.blw +dir zdvj +$ cd zdvj +$ ls +dir bbsmm +251550 sngz.qsd +120940 zlmcvg +$ cd bbsmm +$ ls +206509 bsddjdv +$ cd .. +$ cd .. +$ cd .. +$ cd shjv +$ ls +17754 lqqz.qmf +265175 rdmsqztj.lnt +$ cd .. +$ cd wsvfbb +$ ls +dir bhbb +271856 fzwrr.ndp +114188 hgfjq.jvn +dir jgnl +dir qnddp +51700 rwdnzwhv.vtr +$ cd bhbb +$ ls +107036 rwhffw.pld +$ cd .. +$ cd jgnl +$ ls +dir qld +$ cd qld +$ ls +39294 rbsvwh +$ cd .. +$ cd .. +$ cd qnddp +$ ls +dir vzmrb +58723 wcbz.dwh +$ cd vzmrb +$ ls +203361 rvrbgd.cpw +167876 zgpdcb.rql +$ cd .. +$ cd .. +$ cd .. +$ cd .. +$ cd rbmstsf +$ ls +dir bbsmm +dir cfvhc +63250 hcdlfmt.ccg +dir mgzl +dir ngflwbmp +dir shvjprl +123258 spqchmj.wpv +$ cd bbsmm +$ ls +dir cfvhc +dir gtvszgs +6558 nzdhg +121160 qld +dir rfjfp +dir rwhffw +dir sbfshph +$ cd cfvhc +$ ls +dir btmbjrw +dir pzq +133178 sngz.qsd +$ cd btmbjrw +$ ls +dir ftpvz +dir tjflfshs +dir wvncjmf +$ cd ftpvz +$ ls +dir lqlrh +$ cd lqlrh +$ ls +114380 pcn.cbn +$ cd .. +$ cd .. +$ cd tjflfshs +$ ls +274555 bbsmm.wpr +$ cd .. +$ cd wvncjmf +$ ls +dir nnrqcfmm +$ cd nnrqcfmm +$ ls +217188 pct.bbd +$ cd .. +$ cd .. +$ cd .. +$ cd pzq +$ ls +89797 sngz.qsd +255100 thg +$ cd .. +$ cd .. +$ cd gtvszgs +$ ls +87661 sngz.qsd +$ cd .. +$ cd rfjfp +$ ls +130164 cfvhc.rbt +dir lhf +dir qld +20799 qld.gts +dir qwzj +150977 sngz.qsd +$ cd lhf +$ ls +125848 lvgv.jtg +81087 mdcw.rbv +80091 qld +dir rmsggp +49093 thf.jnh +dir tmf +dir zdvj +$ cd rmsggp +$ ls +dir fznsmbq +dir lhghnn +dir zdvj +$ cd fznsmbq +$ ls +dir wqzwsspq +dir zdvj +$ cd wqzwsspq +$ ls +dir gbzfpfq +$ cd gbzfpfq +$ ls +185410 pct.bbd +$ cd .. +$ cd .. +$ cd zdvj +$ ls +140384 pct.bbd +$ cd .. +$ cd .. +$ cd lhghnn +$ ls +36868 fpj +181925 pct.bbd +$ cd .. +$ cd zdvj +$ ls +256916 bbsmm.mtr +dir rwhffw +75846 rwztfcj.qns +$ cd rwhffw +$ ls +234834 bbsmm.gtp +140315 pbwqrps +$ cd .. +$ cd .. +$ cd .. +$ cd tmf +$ ls +88583 dhndg +52796 qld.mlp +$ cd .. +$ cd zdvj +$ ls +8822 pct.bbd +221658 sngz.qsd +$ cd .. +$ cd .. +$ cd qld +$ ls +119026 dfc.bgr +87684 fzwrr.ndp +dir zdvj +212120 zdvj.jhw +$ cd zdvj +$ ls +dir cfvhc +169434 mhlpvf.vjz +$ cd cfvhc +$ ls +243919 brtvv +$ cd .. +$ cd .. +$ cd .. +$ cd qwzj +$ ls +101395 qcjvs.mjs +$ cd .. +$ cd .. +$ cd rwhffw +$ ls +94012 fzwrr.ndp +205816 hqrgfm.wwt +dir lzbmzw +155203 qjv +$ cd lzbmzw +$ ls +dir dfrdczdj +$ cd dfrdczdj +$ ls +126459 tphtshwc +$ cd .. +$ cd .. +$ cd .. +$ cd sbfshph +$ ls +229389 ccbgcv +135997 cfvhc.ctl +119490 rwhffw.pqp +94530 vjtjz.cfs +$ cd .. +$ cd .. +$ cd cfvhc +$ ls +dir cmr +dir jvh +dir mjs +$ cd cmr +$ ls +227026 fpj +$ cd .. +$ cd jvh +$ ls +dir qld +$ cd qld +$ ls +96968 phthcq +$ cd .. +$ cd .. +$ cd mjs +$ ls +98117 qld.ftd +$ cd .. +$ cd .. +$ cd mgzl +$ ls +198793 nfvnfqn.zwd +$ cd .. +$ cd ngflwbmp +$ ls +dir bbsmm +dir jthnmqs +137176 nrn +80344 ntbq.ssw +133166 phthcq +210691 sngz.qsd +255501 vgwn.gqr +dir zdvj +$ cd bbsmm +$ ls +98501 npwwzjgt +134593 sngz.qsd +46020 tjszcpm.brs +213591 zdvj.sgj +$ cd .. +$ cd jthnmqs +$ ls +dir bbsmm +dir cfdbp +dir dpwqmbw +67233 lzz.tmg +21344 pzvjlt.qdb +dir rwhffw +dir sdtntw +268059 vwhqh +dir zdvj +$ cd bbsmm +$ ls +263767 fpj +46528 tpq.wtb +$ cd .. +$ cd cfdbp +$ ls +dir grczc +$ cd grczc +$ ls +241829 vnnjnz.nww +$ cd .. +$ cd .. +$ cd dpwqmbw +$ ls +287899 pct.bbd +$ cd .. +$ cd rwhffw +$ ls +41741 ffsqr.cwc +dir ffzc +dir nrs +279620 qchg +$ cd ffzc +$ ls +10583 pct.bbd +$ cd .. +$ cd nrs +$ ls +195239 zdvj.npp +$ cd .. +$ cd .. +$ cd sdtntw +$ ls +245601 fpj +9552 lgftw.ntj +$ cd .. +$ cd zdvj +$ ls +dir smjvcql +$ cd smjvcql +$ ls +dir qcqljj +$ cd qcqljj +$ ls +286791 fhm +$ cd .. +$ cd .. +$ cd .. +$ cd .. +$ cd zdvj +$ ls +dir bcghd +57663 fzwrr.ndp +177473 gzpfmsz.tnw +53543 pswpr +251188 sngz.qsd +dir snqjl +$ cd bcghd +$ ls +106732 sjvhjd +dir vtgsnb +$ cd vtgsnb +$ ls +dir gtj +$ cd gtj +$ ls +151689 nncsjvn.vhd +$ cd .. +$ cd .. +$ cd .. +$ cd snqjl +$ ls +104993 bjjqd.pqv +233367 fzwrr.ndp +11942 sngz.qsd +$ cd .. +$ cd .. +$ cd .. +$ cd shvjprl +$ ls +130539 jpzsdjw.hlz +$ cd .. +$ cd .. +$ cd twjcmp +$ ls +86053 pct.bbd \ No newline at end of file diff --git a/src/main.rs b/src/main.rs index 5f814a2..b1c15d7 100644 --- a/src/main.rs +++ b/src/main.rs @@ -60,5 +60,9 @@ fn main() -> Result<()> { let solution = prob7::solve_part1(include_str!("../prob7_part1.txt"))?; println!("Solution for problem 7 part 1: {solution}"); } + { + let solution = prob7::solve_part2(include_str!("../prob7_part2.txt"))?; + println!("Solution for problem 7 part 2: {solution}"); + } Ok(()) } diff --git a/src/prob7.rs b/src/prob7.rs index 6cf4dac..1b00105 100644 --- a/src/prob7.rs +++ b/src/prob7.rs @@ -113,7 +113,6 @@ fn generate_tree(content: &str) -> color_eyre::Result> { let mut curr = root; for line in lines { - println!("{line:?}"); match line { Line::Command(cmd) => match cmd { Command::Ls => {} @@ -136,7 +135,7 @@ fn generate_tree(content: &str) -> color_eyre::Result> { Line::Entry(entry) => match entry { Entry::Dir(_) => {} Entry::File(size, name) => { - curr = tree.insert( + tree.insert( Node::new(FsEntry { path: name, size }), InsertBehavior::UnderNode(&curr), )?; @@ -157,3 +156,20 @@ pub fn solve_part1(content: &str) -> color_eyre::Result { .sum::(); Ok(sum) } + +pub fn solve_part2(content: &str) -> color_eyre::Result { + let total_space = 70000000_u64; + let tree = generate_tree(content)?; + let used_space = total_size(&tree, tree.get(tree.root_node_id().unwrap())?)?; + let free_space = total_space.checked_sub(dbg!(used_space)).unwrap(); + let needed_free_space = 30000000_u64; + let minimum_space_to_free = needed_free_space.checked_sub(free_space).unwrap(); + + let size_to_remove = tree + .traverse_pre_order(tree.root_node_id().unwrap())? + .filter(|n| !n.children().is_empty()) + .map(|n| total_size(&tree, n).unwrap()) + .filter(|&s| s >= minimum_space_to_free) + .min().unwrap(); + Ok(size_to_remove) +} From fd7416456bf8a9ec605a60fc7abf71a3d4867321 Mon Sep 17 00:00:00 2001 From: Pcornat Date: Wed, 20 Sep 2023 20:53:35 +0200 Subject: [PATCH 13/19] Remove dbg! --- src/prob7.rs | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/src/prob7.rs b/src/prob7.rs index 1b00105..c4fa64d 100644 --- a/src/prob7.rs +++ b/src/prob7.rs @@ -161,7 +161,7 @@ pub fn solve_part2(content: &str) -> color_eyre::Result { let total_space = 70000000_u64; let tree = generate_tree(content)?; let used_space = total_size(&tree, tree.get(tree.root_node_id().unwrap())?)?; - let free_space = total_space.checked_sub(dbg!(used_space)).unwrap(); + let free_space = total_space.checked_sub(used_space).unwrap(); let needed_free_space = 30000000_u64; let minimum_space_to_free = needed_free_space.checked_sub(free_space).unwrap(); From 9bd074744bae14ad43fd0bd2ad0cf83acbe5522a Mon Sep 17 00:00:00 2001 From: Pcornat Date: Wed, 20 Sep 2023 21:06:01 +0200 Subject: [PATCH 14/19] Adding beginning of problem 8 --- prob8_part1.txt | 99 +++++++++++++++++++++++++++++++++++++++++++++++++ src/lib.rs | 2 + src/prob8.rs | 0 3 files changed, 101 insertions(+) create mode 100644 prob8_part1.txt create mode 100644 src/prob8.rs diff --git a/prob8_part1.txt b/prob8_part1.txt new file mode 100644 index 0000000..ff5cf01 --- /dev/null +++ b/prob8_part1.txt @@ -0,0 +1,99 @@ +101232232424431123432342554040352101405502025646520640026102435415402415524241404341001022013221221 +322003200404313034023203145443134010555246652210042156042654635314322525041550121322403330300102030 +300223331202022110511510154103110142442012332003514242206354525511353252421542430110200442102312123 +323133401312301310040251134225352136126616004434252462045055305202261355433025233042244241414400023 +101104403040123044220034201231621525016350121330311611014454116414515052210415423202213344444213032 +023343200312321341111312312116004553510400124564003503525336352206534312634553034341344231103320121 +232432314323445335412313341660535056605316245521312422204421411026063010063200110052210224330113302 +312104103023300150511003256056530232416620641476331566726505005253550226461151520445555123411440334 +212320403040021521143113451320122514052261721742217616232666314261562006620634125252332350322233244 +121203010304521210411013440333264052674653423316314375512175574325262425522003540134541121330431412 +242204210504314451204236552066106466756545677241223651236433541213145114512054256134345025222414332 +142041442305525524414554456630445566671622363554565311414164346521375126616036343225552430320142242 +444343225200452531125463161044526512711315644346716774456167633775552325212323502414500125304101442 +310331200433511524004324523024376145644272331714275745132552527332621757111641110604243400150102301 +324000410032344243443213031215347666416142612722352331527416524446272144632054626460610411343015214 +320123043045014453006030311336322753322266368648765847556774576424774346643352662320364111534525122 +442020510341512162315013222156456642565478638555682735664832583554422245165431250246236222000222413 +414115045035446663521337425454354252666867442648382483378248585426324451353146435112651062444320153 +404031553354665600421273415333424442557623485578324525478673862565714171753646445146504611043544310 +420221121313524320031226342733736342778854854745272737436344833444332262273475742543435414301514022 +102433434104221136261652367123828833742266365587682657232782236687733375147446456435013164623033453 +254052000640223505333752451714435245653688563475537427586864344637533256524566641541066561013340115 +402424554664414061612366662262546262344862767983768964383722283664424826344415366464635564003035522 +453430306616221255375164464844337767643264664566433699446375333477788728421713267327336401105425333 +424340460333633611416743647223584543446663447884569869575943675246265858843135752722203060601314510 +100104404661641521713564623486853464898563575445444677875368568656336855687665453132126163413415413 +215302243412504531566112426534574499379653449589737746345943794657936355232887343422456306315453552 +510025400262416244231532674726546437535536634838644683689356756484986473434524723553734023111254223 +200204056365027317421364428852638397454355393937474567465453855598477485557424664756156234516125002 +315311346005136326466555385687277868747539849498675894853944993694973352587363421743725352145116525 +003432325612552157642734768322776884596464869575664456575756766387847762385773543511142455502615010 +323005315540227472658648485349375446787359896487975999967994878588768333826274268465567534243515604 +440456221306764751672857476368954437466478794954588479785445855488353476362467345856473677540155641 +145626220661445722124873768476448493998999449996678498948886598577843394688625385873326644342243461 +445562611272117173322737877366885654845578785685455598488999678884466965543672555556173431656206420 +025130063437366574263434683849438959768954744996857595658945978854575385745862424366457372746221315 +330056343042353748468655383756666954488668996955869957549949945974898849943638748754612625120241011 +432440053115343158276372498785736949588874688959799775598548957878884775394762348284137737673641642 +102056040435747284853655648443579469664944568788855866779976889755858957959735324265746533251062403 +225266001744262443233334974839654865799445785659659675575666575758865948754463425885535443736632404 +110654201772435145572468544985578676579996656795879868576797847675977856844578738333816426565246622 +433122252566473253723864943786447484655995769756667897965855958658757798373853334626865115523210441 +556541053615336747283763545495655688878588665885858779779899597977449644485399674475255622322020110 +011246513266431242864686953687878987686577868895997988788689566679898456889984483487464125476243224 +146430654214211787457337933537555866765688875799887976988578679556659655564463526386463716114354031 +301355426474121386642848739759597465855588776978689979798756956985699554573779455545642175346410200 +665401551644225425227738385396554475758768868798997798968696775989794666575779876332737347375414225 +512264373337161748463436934959669586879679979679896989676576695988989664437878448276827532543745623 +414644336467578472474486349936485857567669856689768668976766988984549484863488738455255412422624432 +036441527146156483775836379836679964765795668878769977878799767597698768864788657252857655434752204 +444666167464342238764266465439498755555659877886888899999856978994556568955445528325646125672164600 +554433027362778886523875976836986988896695897689678886787996679658974797569374338344624672757631301 +310042272613272624885896949859765467876555996976999696789988967965466684754895746762223775172234330 +216343113411562425626633578339674859855875577977769879987785777674498658748899947272432652777416624 +644655617213144523726243646388856494887979798868676998696768878865895676484383655444254627274131426 +563636621655445248723867836434648597896597866798698876698598597697577776937367826877324161661354535 +341056514244726338453499673897657855866875759776669996869785685895756748635866544776371413425025432 +044435013274135828365337573975868886748866596788969877955955756895957574564469583387354142524005261 +410342122777647883362439734978585444678669878589755875966798767797995783366779884352756543534151243 +441043541147123324228379874699597946948555885687569696976589658895855548467778233287211424145465240 +013520313145473358567557484588597487658658866969675558679557775795544577887779883542724441435601554 +413424243572773133387782457533847759697988966666777979879595749686579798343746884752342364430012243 +326240460425117754473464599468874499568546888968889968769655795459984446735672755758632161131203442 +300131303151234667345248566663377796947878745698979798686969577865488637644574724367556777536526223 +201413522556166618225635288589984557686665556767657595967679955648876746974783378576524471465423550 +132203011242354537628633669369699337985447975976769776866447886769358896665782776877447544703406253 +133532343456535111383888625455386597867455655599757897755558666966586346883426636652263242705454404 +515656631143165354267432455336475494569987585578555494867798784856975634394283638544164731533012364 +140416432445724172247278853455798367884868796498777454967657748875548789832362674732676672056032431 +330330152414564665274243438433876363573585996985888846846845663567545668252624564762246173301325502 +302226105363143741352735557782868788733464859494486947884994938599357344542482523627145432560642353 +145422126105171466242567724557544489934658889494656859885599738537534845443644581256761746362221023 +441212145032074213275667582428345868377677696997785565377585765567746584667226657214272426340532331 +101452412564254231314347763234647978536934546886949376683847693599962882662556735366332605253254243 +242134245465654443763242368746262775635568895968649374696544643593776484646237623121155311612120205 +224324556334241543152423764688727563658665947774377475559746775387478253676754241443542553641515133 +112040215053533166723764146688552662254436968389648683363668663468622524888354726754315425216123100 +021125312165155354236637163434868472666833569875463833389786585853644277477624254454065142204421252 +524302450104653624156271174347323843256576684986975339949343684428633575452572646373611442213410412 +013000504615163043526333634318868574767387865682722275245644673556658444321441613432604542203511551 +242524501014131565575336754147245826628343573377352338767422674636538742125631345462033033403235255 +304401342145144243415545241676576556264543764465565724532645542743372525221461725562353265045051132 +234302031320344616366225577677124763333456446683735866667852458578422752674576640145530645050512154 +132421020111321255530526663734272513535262623562488642564636574385245112665623132642441334102314011 +102255335052511135645343464117315257162723258847453624673355647345665737125672220566436213014134441 +312245204230352351210405226233122343511172545755556267356584643164226213732752212035632152433154320 +433104142453501532612362446717232767156326652752737733565427127523161253271344216136060252512442041 +212230512443134051666444123274474475364671426411226276576372452514665156262633036430153240020401401 +300411330411451231141436052664142373444325735263226333375416444576253146002526306114152241250403310 +101032115301513352525160453141002773563414647477456721366627231126771542123126102455031250033223313 +324233212142235532140166110023400026333355425117234444773232146225326253461050325545343105500423104 +033431121034120033510616215166546146337352752676632624643526424216650102540533503153134132000420142 +240121103430140123513513462300432156652122676414274512336151334241532064154406340323144200421003324 +233142431112012541421523134462664026316416350553765272706623513350020256351263445534113304131112033 +323203003131024144404243206121423310355043066662201116504344265455134633403341445324024304010343200 +133044014403300041520020101412541120000145660632333004501603416535515112534533414430000213113231220 +020200134443230224532201430335140300110631641143466045463552301460233403451514045510012313003444012 +003320111443312431412215134024143654125511235514301244523512535041410415313130552501342112344000332 +223322121002242440120225413345342544646200604640400343653451404544533034511344250023302010222012033 \ No newline at end of file diff --git a/src/lib.rs b/src/lib.rs index ed07268..512239d 100644 --- a/src/lib.rs +++ b/src/lib.rs @@ -5,3 +5,5 @@ pub mod prob4; pub mod prob5; pub mod prob6; pub mod prob7; + +pub mod prob8; diff --git a/src/prob8.rs b/src/prob8.rs new file mode 100644 index 0000000..e69de29 From 35ee5c5f46a18b54619fbe531ca8674ac6321c4a Mon Sep 17 00:00:00 2001 From: Pcornat Date: Tue, 26 Sep 2023 22:39:07 +0200 Subject: [PATCH 15/19] Adding petgraph library for graphs. --- Cargo.toml | 1 + 1 file changed, 1 insertion(+) diff --git a/Cargo.toml b/Cargo.toml index bfa6921..76f5ab8 100644 --- a/Cargo.toml +++ b/Cargo.toml @@ -16,3 +16,4 @@ itertools = "0.11.0" camino = "1.1.6" id_tree = "1.8.0" color-eyre = "0.6.2" +petgraph = "0.6.4" From 50398677e8f45b231aa34201b4b02dac7a1711e7 Mon Sep 17 00:00:00 2001 From: Pcornat Date: Tue, 26 Sep 2023 23:09:19 +0200 Subject: [PATCH 16/19] Removing warning --- src/prob7.rs | 1 + 1 file changed, 1 insertion(+) diff --git a/src/prob7.rs b/src/prob7.rs index c4fa64d..cbd100d 100644 --- a/src/prob7.rs +++ b/src/prob7.rs @@ -44,6 +44,7 @@ impl From for Command { } } +#[allow(dead_code)] #[derive(Debug, Default)] struct FsEntry { path: Utf8PathBuf, From 47c0f0bf76418d7f73a4114c8d1dda43fc4bfb1f Mon Sep 17 00:00:00 2001 From: Pcornat Date: Thu, 5 Oct 2023 23:08:20 +0200 Subject: [PATCH 17/19] Vertices added to graph --- src/prob8.rs | 33 +++++++++++++++++++++++++++++++++ 1 file changed, 33 insertions(+) diff --git a/src/prob8.rs b/src/prob8.rs index e69de29..3b68829 100644 --- a/src/prob8.rs +++ b/src/prob8.rs @@ -0,0 +1,33 @@ +use petgraph::prelude::*; +use petgraph::matrix_graph::MatrixGraph; + +pub fn solve_part1(content: &str) -> color_eyre::Result { + let (n_line, numbers) = { + let mut num_rows = 0_usize; + let mut inner_number = Vec::::new(); + content.lines().for_each(|line| { + let mut line_numbers = line + .chars() + .map(|c| c.to_digit(10).unwrap()) + .collect::>(); + inner_number.append(&mut line_numbers); + num_rows += 1; + }); + (num_rows, inner_number) + }; + let m_element = numbers.len() / n_line; + let _visible_border = (m_element + n_line) * 2 - 4; + + let num_slice = numbers.as_slice(); + let mut node_indices = vec![NodeIndex::::default(); num_slice.len()]; + let idx_slice = node_indices.as_mut_slice(); + let mut graph = MatrixGraph::::with_capacity(m_element * n_line); + for j in 0..n_line { + for i in 0..m_element { + let idx = j * m_element + i; + idx_slice[idx] = graph.add_node(num_slice[idx]); + } + } + + Ok(0) +} From 22ada9b454a2a66add1b73e478d56b8f8dd5ea2e Mon Sep 17 00:00:00 2001 From: Pcornat Date: Thu, 5 Oct 2023 23:29:30 +0200 Subject: [PATCH 18/19] Adding edges --- src/prob8.rs | 20 +++++++++++++++++++- 1 file changed, 19 insertions(+), 1 deletion(-) diff --git a/src/prob8.rs b/src/prob8.rs index 3b68829..3c423f2 100644 --- a/src/prob8.rs +++ b/src/prob8.rs @@ -1,5 +1,5 @@ -use petgraph::prelude::*; use petgraph::matrix_graph::MatrixGraph; +use petgraph::prelude::*; pub fn solve_part1(content: &str) -> color_eyre::Result { let (n_line, numbers) = { @@ -26,6 +26,24 @@ pub fn solve_part1(content: &str) -> color_eyre::Result { for i in 0..m_element { let idx = j * m_element + i; idx_slice[idx] = graph.add_node(num_slice[idx]); + if (i as i64 - 1) >= 0 { + let previous_same_row = idx - 1; + graph.add_edge(idx_slice[idx], idx_slice[previous_same_row], num_slice[idx]); + graph.add_edge( + idx_slice[previous_same_row], + idx_slice[idx], + num_slice[previous_same_row], + ); + } + if (j as i64 - 1) >= 0 { + let previous_same_col = idx - m_element; + graph.add_edge(idx_slice[idx], idx_slice[previous_same_col], num_slice[idx]); + graph.add_edge( + idx_slice[previous_same_col], + idx_slice[idx], + num_slice[previous_same_col], + ); + } } } From 19615ebdb5bdeff8aba26c5d228afc2902688e7c Mon Sep 17 00:00:00 2001 From: Pcornat Date: Mon, 15 Sep 2025 21:08:25 +0200 Subject: [PATCH 19/19] Update nom --- Cargo.toml | 4 ++-- src/prob5.rs | 35 ++++++++++++++++++++++------------- src/prob7.rs | 21 ++++++++++++--------- 3 files changed, 36 insertions(+), 24 deletions(-) diff --git a/Cargo.toml b/Cargo.toml index 76f5ab8..34bb019 100644 --- a/Cargo.toml +++ b/Cargo.toml @@ -11,8 +11,8 @@ incremental = true rpath = true [dependencies] -nom = "7.1.1" -itertools = "0.11.0" +nom = "8.0.0" +itertools = "0.14.0" camino = "1.1.6" id_tree = "1.8.0" color-eyre = "0.6.2" diff --git a/src/prob5.rs b/src/prob5.rs index 3080d39..7dfb3d1 100644 --- a/src/prob5.rs +++ b/src/prob5.rs @@ -5,8 +5,8 @@ use nom::{ branch::alt, bytes::complete::{tag, take, take_while1}, combinator::{all_consuming, map, map_res, opt}, - Finish, - IResult, sequence::{delimited, preceded, tuple}, + sequence::{delimited, preceded}, + Finish, IResult, Parser, }; #[derive(Debug)] @@ -27,17 +27,17 @@ struct Instruction { fn parse_crate(i: &str) -> IResult<&str, char> { let first_char = |s: &str| s.chars().next().unwrap(); let f = delimited(tag("["), take(1_usize), tag("]")); - map(f, first_char)(i) + map(f, first_char).parse(i) } fn parse_hole(i: &str) -> IResult<&str, ()> { // `drop` takes a value and returns nothing, which is // perfect for our case - map(tag(" "), drop)(i) + map(tag(" "), drop).parse(i) } fn parse_crate_or_hole(i: &str) -> IResult<&str, Option> { - alt((map(parse_crate, Some), map(parse_hole, |_| None)))(i) + alt((map(parse_crate, Some), map(parse_hole, |_| None))).parse(i) } fn parse_crate_line(i: &str) -> IResult<&str, Vec>> { @@ -45,7 +45,7 @@ fn parse_crate_line(i: &str) -> IResult<&str, Vec>> { let mut v = vec![c]; loop { - let (next_i, maybe_c) = opt(preceded(tag(" "), parse_crate_or_hole))(i)?; + let (next_i, maybe_c) = opt(preceded(tag(" "), parse_crate_or_hole)).parse(i)?; match maybe_c { Some(c) => v.push(c), None => break, @@ -79,29 +79,32 @@ fn transpose_rev(v: Vec>>) -> Vec> { fn parse_number(i: &str) -> IResult<&str, usize> { map_res(take_while1(|c: char| c.is_ascii_digit()), |s: &str| { s.parse::() - })(i) + }) + .parse(i) } fn parse_pile_number(i: &str) -> IResult<&str, usize> { - map(parse_number, |i| i - 1)(i) + map(parse_number, |i| i - 1).parse(i) } fn parse_instruction(i: &str) -> IResult<&str, Instruction> { map( - tuple(( + ( preceded(tag("move "), parse_number), preceded(tag(" from "), parse_pile_number), preceded(tag(" to "), parse_pile_number), - )), + ), |(quantity, src, dst)| Instruction { quantity, src, dst }, - )(i) + ) + .parse(i) } fn parser(content: &str) -> (Vec>, Vec) { let mut lines = content.lines(); let crate_lines = (&mut lines) .map_while(|line| { - all_consuming(parse_crate_line)(line) + all_consuming(parse_crate_line) + .parse(line) .finish() .ok() .map(|(_, line)| line) @@ -119,7 +122,13 @@ fn parser(content: &str) -> (Vec>, Vec) { assert!(lines.next().unwrap().is_empty()); let instructions = lines - .map(|line| all_consuming(parse_instruction)(line).finish().unwrap().1) + .map(|line| { + all_consuming(parse_instruction) + .parse(line) + .finish() + .unwrap() + .1 + }) .collect::>(); (crate_columns, instructions) } diff --git a/src/prob7.rs b/src/prob7.rs index cbd100d..2aa10a5 100644 --- a/src/prob7.rs +++ b/src/prob7.rs @@ -5,7 +5,7 @@ use nom::{ bytes::complete::{tag, take_while1}, combinator::{all_consuming, map}, sequence::{preceded, separated_pair}, - Finish, IResult, + Finish, IResult, Parser, }; #[derive(Debug)] @@ -58,33 +58,35 @@ fn parse_entry(input: &str) -> IResult<&str, Entry> { ); let parse_dir = map(preceded(tag("dir "), parse_path), Entry::Dir); - alt((parse_file, parse_dir))(input) + alt((parse_file, parse_dir)).parse(input) } fn parse_path(input: &str) -> IResult<&str, Utf8PathBuf> { map( take_while1(|c: char| "abcdefghijklmnopqrstuvwxyz./".contains(c)), Into::into, - )(input) + ) + .parse(input) } fn parse_ls(input: &str) -> IResult<&str, Ls> { - map(tag("ls"), |_| Ls)(input) + map(tag("ls"), |_| Ls).parse(input) } fn parse_cd(input: &str) -> IResult<&str, Cd> { - map(preceded(tag("cd "), parse_path), Cd)(input) + map(preceded(tag("cd "), parse_path), Cd).parse(input) } fn parse_command(line: &str) -> IResult<&str, Command> { let (input, _) = tag("$ ")(line)?; - alt((map(parse_ls, Into::into), map(parse_cd, Into::into)))(input) + alt((map(parse_ls, Into::into), map(parse_cd, Into::into))).parse(input) } fn parse_line(input: &str) -> IResult<&str, Line> { alt(( map(parse_command, Line::Command), map(parse_entry, Line::Entry), - ))(input) + )) + .parse(input) } fn total_size(tree: &Tree, node: &Node) -> color_eyre::Result { @@ -97,7 +99,7 @@ fn total_size(tree: &Tree, node: &Node) -> color_eyre::Result< fn generate_tree(content: &str) -> color_eyre::Result> { let lines = content.lines().map(|line| { - all_consuming(parse_line)(line) + all_consuming(parse_line).parse(line) .finish() .unwrap_or_else(|err| panic!("{err}")) .1 @@ -171,6 +173,7 @@ pub fn solve_part2(content: &str) -> color_eyre::Result { .filter(|n| !n.children().is_empty()) .map(|n| total_size(&tree, n).unwrap()) .filter(|&s| s >= minimum_space_to_free) - .min().unwrap(); + .min() + .unwrap(); Ok(size_to_remove) }